- SP140 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49517
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- SP140
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: LSLLPGEGEE GSDDCSEMCD GEERQEASSS LARRGSVSSE LENHPMNEEG ESEELASSLL YDNVPGAEQS A
- SP140 nuclear body protein
- LYSP100, LYSP100-A, LYSP100-B
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA
Specifications/Features
Available conjugates: Unconjugated